PRELP antibody (Middle Region)

Catalog No. ABIN633916

Product Details anti-PRELP Antibody

Target: PRELP (Proline Arginine Rich End Leucine Rich Repeat Protein (PRELP))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PRELP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRELP antibody was raised against the middle region of PRELP

Purification: Affinity purified

Immunogen: PRELP antibody was raised using the middle region of PRELP corresponding to a region with amino acids SNKIETIPNGYFKSFPNLAFIRLNYNKLTDRGLPKNSFNISNLLVLHLSH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRELP Blocking Peptide, catalog no. 33R-8653, is also available for use as a blocking control in assays to test for specificity of this PRELP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRELP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PRELP

Target: PRELP (Proline Arginine Rich End Leucine Rich Repeat Protein (PRELP))

Alternative Name: PRELP (PRELP Products)

Synonyms: 7330409J17Rik antibody, SLRR2A antibody, MST161 antibody, MSTP161 antibody, proline arginine-rich end leucine-rich repeat antibody, proline and arginine rich end leucine rich repeat protein antibody, Prelp antibody, PRELP antibody

Background: PRELP is a leucine-rich repeat protein present in connective tissue extracellular matrix. This protein functions as a molecule anchoring basement membranes to the underlying connective tissue. This protein has been shown to bind type I collagen to basement membranes and type II collagen to cartilage. It also binds the basement membrane heparan sulfate proteoglycan perlecan. This protein is suggested to be involved in the pathogenesis of Hutchinson-Gilford progeria (HGP), which is reported to lack the binding of collagen in basement membranes and cartilage.

Molecular Weight: 42 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process