ART5 antibody (Middle Region)

Catalog No. ABIN633917

Product Details anti-ART5 Antibody

Target: ART5 (ADP-Ribosyltransferase 5 (ART5))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ART5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ART5 antibody was raised against the middle region of ART5

Purification: Affinity purified

Immunogen: ART5 antibody was raised using the middle region of ART5 corresponding to a region with amino acids VFPKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ART5 Blocking Peptide, catalog no. 33R-9536, is also available for use as a blocking control in assays to test for specificity of this ART5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ART5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ART5

Target: ART5 (ADP-Ribosyltransferase 5 (ART5))

Alternative Name: ART5 (ART5 Products)

Synonyms: ARTC5 antibody, Yac-2 antibody, ART5 antibody, Art5 antibody, art5 antibody, ADP-ribosyltransferase 5 antibody, ecto-ADP-ribosyltransferase 5-like antibody, ecto-ADP-ribosyltransferase 5 antibody, ADP-ribosyltransferase 5 L homeolog antibody, ART5 antibody, Art5 antibody, LOC618664 antibody, LOC100715378 antibody, art5.L antibody

Background: The protein encoded by this gene belongs to the ARG-specific ADP-ribosyltransferase family. Proteins in this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. The mouse homolog lacks a glycosylphosphatidylinositol-anchor signal sequence and is predicted to be a secretory enzyme. Transcript variants with different 5' UTRs, but encoding the same protein have been found for this gene.

Molecular Weight: 30 kDa (MW of target protein)