PCSK5 antibody (Middle Region)

Catalog No. ABIN633925

Product Details anti-PCSK5 Antibody

Target: PCSK5 (Proprotein Convertase Subtilisin/kexin Type 5 (PCSK5))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCSK5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCSK5 antibody was raised against the middle region of PCSK5

Purification: Affinity purified

Immunogen: PCSK5 antibody was raised using the middle region of PCSK5 corresponding to a region with amino acids CAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDIS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCSK5 Blocking Peptide, catalog no. 33R-1642, is also available for use as a blocking control in assays to test for specificity of this PCSK5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCSK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCSK5

Target: PCSK5 (Proprotein Convertase Subtilisin/kexin Type 5 (PCSK5))

Alternative Name: PCSK5 (PCSK5 Products)

Synonyms: PC5 antibody, PC6 antibody, PC6A antibody, SPC6 antibody, subtilase antibody, PC5/6A antibody, PC5A antibody, b2b1549Clo antibody, b2b585Clo antibody, Pc5 antibody, fur2 antibody, spc6 antibody, spc6A antibody, MGC98915 antibody, PCSK5 antibody, pc6 antibody, spc6a antibody, pcsk5 antibody, zgc:165659 antibody, proprotein convertase subtilisin/kexin type 5 antibody, proprotein convertase subtilisin/kexin type 5 S homeolog antibody, proprotein convertase subtilisin/kexin type 5b antibody, PCSK5 antibody, Pcsk5 antibody, pcsk5.S antibody, LOC528098 antibody, pcsk5 antibody, pcsk5b antibody

Background: PCSK5 belongs to the subtilisin-like proprotein convertase family. The members of this family are proprotein convertases that process latent precursor proteins into their biologically active products. PCSK5 mediates posttranslational endoproteolytic processing for several integrin alpha subunits. It is thought to process prorenin, pro-membrane type-1 matrix metalloproteinase and HIV-1 glycoprotein gp160. Two alternatively spliced transcripts are described for this gene but only one has its full length nature known.

Molecular Weight: 89 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway, Regulation of Systemic Arterial Blood Pressure by Hormones