EPHX1 antibody
-
- Target See all EPHX1 Antibodies
- EPHX1 (Epoxide Hydrolase 1, Microsomal (Xenobiotic) (EPHX1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This EPHX1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- EPHX1 antibody was raised using a synthetic peptide corresponding to a region with amino acids GPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKFRFTPPLEDSCFHYG
- Top Product
- Discover our top product EPHX1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
EPHX1 Blocking Peptide, catalog no. 33R-3472, is also available for use as a blocking control in assays to test for specificity of this EPHX1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EPHX1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- EPHX1 (Epoxide Hydrolase 1, Microsomal (Xenobiotic) (EPHX1))
- Alternative Name
- EPHX1 (EPHX1 Products)
- Synonyms
- NV13267 antibody, DRB1 antibody, DSRNA-BINDING PROTEIN 1 antibody, F21M12.9 antibody, F21M12_9 antibody, HYPONASTIC LEAVES 1 antibody, AI195553 antibody, Eph-1 antibody, Eph1 antibody, mEH antibody, EPHX antibody, EPOX antibody, HYL1 antibody, MEH antibody, zgc:56126 antibody, ephx antibody, epox antibody, meh antibody, MEH8 antibody, epoxide hydrolase 1 antibody, epoxide hydrolase 1, microsomal (xenobiotic) antibody, Epoxide hydrolase 1 antibody, dsRNA-binding domain-like superfamily protein antibody, epoxide hydrolase 1, microsomal antibody, epoxide hydrolase 1, microsomal (xenobiotic) L homeolog antibody, EPHX1 antibody, Eh1 antibody, hyep antibody, HYL1 antibody, Ephx1 antibody, ephx1 antibody, ephx1.L antibody
- Background
- Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity.
- Molecular Weight
- 53 kDa (MW of target protein)
-