SERPINC1 antibody
-
- Target See all SERPINC1 Antibodies
- SERPINC1 (Serpin Family C Member 1 (SERPINC1))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SERPINC1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- SERPINC1 antibody was raised using a synthetic peptide corresponding to a region with amino acids ISEKTSDQIHFFFAKLNCRLYRKANKSSKLVSANRLFGDKSLTFNETYQD
- Top Product
- Discover our top product SERPINC1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SERPINC1 Blocking Peptide, catalog no. 33R-4150, is also available for use as a blocking control in assays to test for specificity of this SERPINC1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINC1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SERPINC1 (Serpin Family C Member 1 (SERPINC1))
- Alternative Name
- SERPINC1 (SERPINC1 Products)
- Synonyms
- AT3 antibody, AT3D antibody, ATIII antibody, THPH7 antibody, SERPINC1 antibody, DKFZp470C1733 antibody, AI114908 antibody, At-3 antibody, At3 antibody, ANTITHROMBIN, AT-III antibody, AT-III antibody, serpin family C member 1 antibody, antithrombin-III antibody, serine (or cysteine) peptidase inhibitor, clade C (antithrombin), member 1 antibody, SERPINC1 antibody, CpipJ_CPIJ000472 antibody, CpipJ_CPIJ013111 antibody, Serpinc1 antibody
- Background
- The protein encoded by this gene is a plasma protease inhibitor and a member of the serpin superfamily. This protein inhibits thrombin as well as other activated serine proteases of the coagulation system, and it regulates the blood coagulation cascade.
- Molecular Weight
- 52 kDa (MW of target protein)
-