PNPLA4 antibody (C-Term)
-
- Target See all PNPLA4 Antibodies
- PNPLA4 (Patatin-Like phospholipase Domain Containing 4 (PNPLA4))
-
Binding Specificity
- C-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PNPLA4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- PNPLA4 antibody was raised against the C terminal of PNPLA4
- Purification
- Affinity purified
- Immunogen
- PNPLA4 antibody was raised using the C terminal of PNPLA4 corresponding to a region with amino acids SPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKM
- Top Product
- Discover our top product PNPLA4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PNPLA4 Blocking Peptide, catalog no. 33R-8673, is also available for use as a blocking control in assays to test for specificity of this PNPLA4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPLA4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PNPLA4 (Patatin-Like phospholipase Domain Containing 4 (PNPLA4))
- Alternative Name
- PNPLA4 (PNPLA4 Products)
- Synonyms
- PNPLA4 antibody, DXS1283E antibody, GS2 antibody, iPLA2eta antibody, patatin like phospholipase domain containing 4 L homeolog antibody, patatin like phospholipase domain containing 4 antibody, pnpla4.L antibody, PNPLA4 antibody
- Background
- PNPLA4 is a keratinocyte retinyl ester hydrolase. The protein also catalyzes fatty acyl CoA-dependent and independent retinol esterification, using triolein as substrate and generates diacylglyceride and free fatty acid.
- Molecular Weight
- 28 kDa (MW of target protein)
-