PNPLA4 antibody (C-Term)

Catalog No. ABIN633942

Product Details anti-PNPLA4 Antibody

Target: PNPLA4 (Patatin-Like phospholipase Domain Containing 4 (PNPLA4))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PNPLA4 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PNPLA4 antibody was raised against the C terminal of PNPLA4

Purification: Affinity purified

Immunogen: PNPLA4 antibody was raised using the C terminal of PNPLA4 corresponding to a region with amino acids SPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PNPLA4 Blocking Peptide, catalog no. 33R-8673, is also available for use as a blocking control in assays to test for specificity of this PNPLA4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PNPLA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PNPLA4

Target: PNPLA4 (Patatin-Like phospholipase Domain Containing 4 (PNPLA4))

Alternative Name: PNPLA4 (PNPLA4 Products)

Synonyms: PNPLA4 antibody, DXS1283E antibody, GS2 antibody, iPLA2eta antibody, patatin like phospholipase domain containing 4 L homeolog antibody, patatin like phospholipase domain containing 4 antibody, pnpla4.L antibody, PNPLA4 antibody

Background: PNPLA4 is a keratinocyte retinyl ester hydrolase. The protein also catalyzes fatty acyl CoA-dependent and independent retinol esterification, using triolein as substrate and generates diacylglyceride and free fatty acid.

Molecular Weight: 28 kDa (MW of target protein)