P4HB antibody (N-Term)
-
- Target See all P4HB Antibodies
- P4HB (Prolyl 4-Hydroxylase, beta Polypeptide (P4HB))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This P4HB antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificity
- P4 HB antibody was raised against the N terminal of P4 B
- Purification
- Affinity purified
- Immunogen
- P4 HB antibody was raised using the N terminal of P4 B corresponding to a region with amino acids TIKFFRNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLPDGAAAESLV
- Top Product
- Discover our top product P4HB Primary Antibody
-
-
- Application Notes
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
P4HB Blocking Peptide, catalog no. 33R-9118, is also available for use as a blocking control in assays to test for specificity of this P4HB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 B antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- P4HB (Prolyl 4-Hydroxylase, beta Polypeptide (P4HB))
- Alternative Name
- P4HB (P4HB Products)
- Synonyms
- DSI antibody, ERBA2L antibody, GIT antibody, P4Hbeta antibody, PDI antibody, PDIA1 antibody, PHDB antibody, PO4DB antibody, PO4HB antibody, PROHB antibody, PDA2 antibody, PDIP antibody, PDIR antibody, ERp59 antibody, Pdia1 antibody, Thbp antibody, p55 antibody, XPDIp antibody, pdi antibody, 1810041F13Rik antibody, AI661267 antibody, Pdip antibody, Pdipl antibody, p58 antibody, prolyl 4-hydroxylase subunit beta antibody, protein disulfide isomerase family A member 2 antibody, prolyl 4-hydroxylase, beta polypeptide antibody, protein disulfide isomerase family A member 2 L homeolog antibody, protein disulfide isomerase associated 2 antibody, prolyl 4-hydroxylase subunit beta L homeolog antibody, protein disulfide-isomerase antibody, P4HB antibody, PDIA2 antibody, P4hb antibody, pdia2.L antibody, Pdia2 antibody, p4hb.L antibody, LOC8281065 antibody
- Background
- P4HB is the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.
- Molecular Weight
- 55 kDa (MW of target protein)
- Pathways
- Maintenance of Protein Location, Cell RedoxHomeostasis, Lipid Metabolism
-