ENPP6 antibody (Middle Region)

Catalog No. ABIN633965

Product Details anti-ENPP6 Antibody

Target: ENPP6 (Ectonucleotide pyrophosphatase/phosphodiesterase 6 (ENPP6))

Binding Specificity: Middle Region

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ENPP6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: ENPP6 antibody was raised against the middle region of ENPP6

Purification: Affinity purified

Immunogen: ENPP6 antibody was raised using the middle region of ENPP6 corresponding to a region with amino acids ELMDMRGIFLAFGPDFKSNFRAAPIRSVDVYNVMCNVVGITPLPNNGSWS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ENPP6 Blocking Peptide, catalog no. 33R-2561, is also available for use as a blocking control in assays to test for specificity of this ENPP6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ENPP6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ENPP6

Target: ENPP6 (Ectonucleotide pyrophosphatase/phosphodiesterase 6 (ENPP6))

Alternative Name: ENPP6 (ENPP6 Products)

Synonyms: E-NPP 6 antibody, cb1028 antibody, sb:cb727 antibody, zgc:103605 antibody, NPP6 antibody, NPP-6 antibody, 4833421B01Rik antibody, B830047L21Rik antibody, D8Ertd514e antibody, Npp6 antibody, E-NPP6 antibody, ectonucleotide pyrophosphatase/phosphodiesterase 6 antibody, ectonucleotide pyrophosphatase/phosphodiesterase 6 L homeolog antibody, enpp6 antibody, enpp6.L antibody, ENPP6 antibody, Enpp6 antibody

Background: ENPP6 is a choline-specific glycerophosphodiester phosphodiesterase. ENPP6 hydrolyzes the classical substrate for phospholipase C, p-nitrophenyl phosphorylcholine, while it does not hydrolyze the classical nucleotide phosphodiesterase substrate, p-nitrophenyl thymidine 5'-monophosphate.

Molecular Weight: 50 kDa (MW of target protein)