Phone:
+1 877 302 8632
Fax:
+1 888 205 9894 (Toll-free)
E-Mail:
orders@antibodies-online.com

P4HB antibody (C-Term)

P4HB Reactivity: Human, Mouse, Rat WB Host: Rabbit Polyclonal unconjugated
Catalog No. ABIN633967
  • Target See all P4HB Antibodies
    P4HB (Prolyl 4-Hydroxylase, beta Polypeptide (P4HB))
    Binding Specificity
    • 21
    • 19
    • 15
    • 13
    • 11
    • 5
    • 4
    • 4
    • 3
    • 3
    • 2
    • 2
    • 2
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    • 1
    C-Term
    Reactivity
    • 106
    • 73
    • 64
    • 23
    • 22
    • 20
    • 20
    • 18
    • 18
    • 16
    • 10
    • 10
    • 8
    • 7
    • 6
    • 4
    • 4
    • 1
    • 1
    • 1
    Human, Mouse, Rat
    Host
    • 118
    • 25
    • 2
    Rabbit
    Clonality
    • 109
    • 36
    Polyclonal
    Conjugate
    • 61
    • 16
    • 15
    • 9
    • 4
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 3
    • 2
    • 1
    • 1
    • 1
    • 1
    • 1
    This P4HB antibody is un-conjugated
    Application
    • 111
    • 68
    • 45
    • 43
    • 43
    • 36
    • 18
    • 15
    • 14
    • 13
    • 13
    • 5
    • 5
    • 2
    • 1
    • 1
    • 1
    • 1
    Western Blotting (WB)
    Specificity
    P4 HB antibody was raised against the C terminal of P4 B
    Purification
    Affinity purified
    Immunogen
    P4 HB antibody was raised using the C terminal of P4 B corresponding to a region with amino acids DRTVIDYNGERTLDGFKKFLESGGQDGAGDDDDLEDLEEAEEPDMEEDDD
    Top Product
    Discover our top product P4HB Primary Antibody
  • Application Notes
    WB: 0.25 µg/mL
    Optimal conditions should be determined by the investigator.
    Comment

    P4HB Blocking Peptide, catalog no. 33R-2152, is also available for use as a blocking control in assays to test for specificity of this P4HB antibody

    Restrictions
    For Research Use only
  • Format
    Lyophilized
    Reconstitution
    Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 B antibody in PBS
    Concentration
    Lot specific
    Buffer
    PBS
    Handling Advice
    Avoid repeated freeze/thaw cycles.
    Dilute only prior to immediate use.
    Storage
    4 °C/-20 °C
    Storage Comment
    Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
  • Target
    P4HB (Prolyl 4-Hydroxylase, beta Polypeptide (P4HB))
    Alternative Name
    P4HB (P4HB Products)
    Synonyms
    DSI antibody, ERBA2L antibody, GIT antibody, P4Hbeta antibody, PDI antibody, PDIA1 antibody, PHDB antibody, PO4DB antibody, PO4HB antibody, PROHB antibody, PDA2 antibody, PDIP antibody, PDIR antibody, ERp59 antibody, Pdia1 antibody, Thbp antibody, p55 antibody, XPDIp antibody, pdi antibody, 1810041F13Rik antibody, AI661267 antibody, Pdip antibody, Pdipl antibody, p58 antibody, prolyl 4-hydroxylase subunit beta antibody, protein disulfide isomerase family A member 2 antibody, prolyl 4-hydroxylase, beta polypeptide antibody, protein disulfide isomerase family A member 2 L homeolog antibody, protein disulfide isomerase associated 2 antibody, prolyl 4-hydroxylase subunit beta L homeolog antibody, protein disulfide-isomerase antibody, P4HB antibody, PDIA2 antibody, P4hb antibody, pdia2.L antibody, Pdia2 antibody, p4hb.L antibody, LOC8281065 antibody
    Background
    P4HB is the beta subunit of prolyl 4-hydroxylase, a highly abundant multifunctional enzyme that belongs to the protein disulfide isomerase family. When present as a tetramer consisting of two alpha and two beta subunits, this enzyme is involved in hydroxylation of prolyl residues in preprocollagen. This enzyme is also a disulfide isomerase containing two thioredoxin domains that catalyze the formation, breakage and rearrangement of disulfide bonds. Other known functions include its ability to act as a chaperone that inhibits aggregation of misfolded proteins in a concentration-dependent manner, its ability to bind thyroid hormone, its role in both the influx and efflux of S-nitrosothiol-bound nitric oxide, and its function as a subunit of the microsomal triglyceride transfer protein complex.
    Molecular Weight
    55 kDa (MW of target protein)
    Pathways
    Maintenance of Protein Location, Cell RedoxHomeostasis, Lipid Metabolism
You are here:
Support