CPN1 antibody (Middle Region)

Catalog No. ABIN633971

Product Details anti-CPN1 Antibody

Target: CPN1 (Carboxypeptidase N Subunit 1 (CPN1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CPN1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Carboxypeptidase N1 antibody was raised against the middle region of CPN1

Purification: Affinity purified

Immunogen: Carboxypeptidase N1 antibody was raised using the middle region of CPN1 corresponding to a region with amino acids FQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Carboxypeptidase N1 Blocking Peptide, catalog no. 33R-3033, is also available for use as a blocking control in assays to test for specificity of this Carboxypeptidase N1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CPN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CPN1

Target: CPN1 (Carboxypeptidase N Subunit 1 (CPN1))

Alternative Name: Carboxypeptidase N1 (CPN1 Products)

Synonyms: CPN antibody, SCPN antibody, Cpn antibody, cb1037 antibody, fa99g08 antibody, wu:fa99g08 antibody, zgc:77485 antibody, cpn antibody, scpn antibody, 0610011F20Rik antibody, carboxypeptidase N subunit 1 antibody, carboxypeptidase N, polypeptide 1 antibody, carboxypeptidase N subunit 1 S homeolog antibody, CPN1 antibody, Cpn1 antibody, cpn1 antibody, cpn1.S antibody

Background: Carboxypeptidase N is a plasma metallo-protease that cleaves basic amino acids from the C terminal of peptides and proteins. The enzyme is important in the regulation of peptides like kinins and anaphylatoxins, and has also been known as kininase-1 and anaphylatoxin inactivator. This enzyme is a tetramer comprised of two identical regulatory subunits and two identical catalytic subunits, this gene encodes the catalytic subunit. Mutations in this gene can be associated with angioedema or chronic urticaria resulting from carboxypeptidase N deficiency.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis, Peptide Hormone Metabolism, Regulation of Systemic Arterial Blood Pressure by Hormones, C21-Steroid Hormone Metabolic Process