CYP2C18 antibody (N-Term)

Catalog No. ABIN633982

Product Details anti-CYP2C18 Antibody

Target: CYP2C18 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 18 (CYP2C18))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP2C18 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP2 C18 antibody was raised against the N terminal of CYP2 18

Purification: Affinity purified

Immunogen: CYP2 C18 antibody was raised using the N terminal of CYP2 18 corresponding to a region with amino acids MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDM

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP2C18 Blocking Peptide, catalog no. 33R-5855, is also available for use as a blocking control in assays to test for specificity of this CYP2C18 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 18 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP2C18

Target: CYP2C18 (Cytochrome P450, Family 2, Subfamily C, Polypeptide 18 (CYP2C18))

Alternative Name: CYP2C18 (CYP2C18 Products)

Synonyms: CPCJ antibody, CYP2C antibody, P450C2C antibody, P450IIC19 antibody, CPCI antibody, CYP2C17 antibody, P450-6B/29C antibody, P450IIC17 antibody, cpci antibody, cyp2c antibody, cyp2c17 antibody, p450-6b/29c antibody, p450iic17 antibody, CYP2C18 antibody, MGC139147 antibody, cytochrome P450 family 2 subfamily C member 19 antibody, cytochrome P450 family 2 subfamily C member 18 antibody, cytochrome P450 family 2 subfamily C member 18 L homeolog antibody, cytochrome P450, family 2, subfamily C, polypeptide 18 antibody, CYP2C19 antibody, CYP2C18 antibody, cyp2c18.L antibody, cyp2c18 antibody

Background: This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molecular Weight: 56 kDa (MW of target protein)