RDH11 antibody

Catalog No. ABIN633983

Product Details anti-RDH11 Antibody

Target: RDH11 (Retinol Dehydrogenase 11 (All-Trans/9-Cis/11-Cis) (RDH11))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RDH11 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: RDH11 antibody was raised using a synthetic peptide corresponding to a region with amino acids SFFIKTPQQGAQTSLHCALTEGLEILSGNHFSDCHVAWVSAQARNETIAR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RDH11 Blocking Peptide, catalog no. 33R-8425, is also available for use as a blocking control in assays to test for specificity of this RDH11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RDH11

Target: RDH11 (Retinol Dehydrogenase 11 (All-Trans/9-Cis/11-Cis) (RDH11))

Alternative Name: RDH11 (RDH11 Products)

Synonyms: RDH11 antibody, 2610319N22Rik antibody, AI428145 antibody, AU045252 antibody, Arsdr1 antibody, C85936 antibody, CGI-82 antibody, HCBP12 antibody, M42C60 antibody, Mdt1 antibody, Psdr1 antibody, SCALD antibody, UBE-1c1 antibody, Ube-1c antibody, ARSDR1 antibody, CGI82 antibody, MDT1 antibody, PSDR1 antibody, RALR1 antibody, SDR7C1 antibody, retinol dehydrogenase 11 (all-trans/9-cis/11-cis) S homeolog antibody, retinol dehydrogenase 11 (all-trans/9-cis/11-cis) antibody, retinol dehydrogenase 11 antibody, rdh11.S antibody, RDH11 antibody, Rdh11 antibody

Background: RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.RHD11, a member of the short-chain dehydrogenase/reductase (SDR) superfamily of oxidoreductases, is expressed at high levels in prostate epithelium, and its expression is regulated by androgens.

Molecular Weight: 35 kDa (MW of target protein)