CYP2B6 antibody (Middle Region)

Catalog No. ABIN633985

Product Details anti-CYP2B6 Antibody

Target: CYP2B6 (Cytochrome P450, Family 2, Subfamily B, Polypeptide 6 (CYP2B6))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CYP2B6 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CYP2 B6 antibody was raised against the middle region of CYP2 6

Purification: Affinity purified

Immunogen: CYP2 B6 antibody was raised using the middle region of CYP2 6 corresponding to a region with amino acids QLFELFSGFLKYFPGAHRQVYKNLQEINAYIGHSVEKHRETLDPSAPKDL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CYP2B6 Blocking Peptide, catalog no. 33R-7624, is also available for use as a blocking control in assays to test for specificity of this CYP2B6 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CYP0 6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CYP2B6

Target: CYP2B6 (Cytochrome P450, Family 2, Subfamily B, Polypeptide 6 (CYP2B6))

Alternative Name: CYP2B6 (CYP2B6 Products)

Synonyms: CPB6 antibody, CYP2B antibody, CYP2B7 antibody, CYP2B7P antibody, CYPIIB6 antibody, EFVM antibody, IIB1 antibody, P450 antibody, CPF3 antibody, CYP4F antibody, LTB4H antibody, CYP2B30 antibody, CYP2B11 antibody, CYPIIB11 antibody, 21-OH antibody, 21OH antibody, 21OHA antibody, 21OHB antibody, CYP21OH-A antibody, Cyp21 antibody, Cyp21-ps1 antibody, Cyp21B antibody, Cyp21a2-ps antibody, Cyp21a2ps antibody, Oh21-1 antibody, Oh21-2 antibody, CYP2B6 antibody, cytochrome P450 family 2 subfamily B member 6 antibody, cytochrome P450 family 4 subfamily F member 3 antibody, cytochrome P450, family 2, subfamily B, polypeptide 6 antibody, cytochrome P450 family 2 subfamily B member 6 L homeolog antibody, cytochrome P450 2B11 antibody, cytochrome P450, family 21, subfamily a, polypeptide 1 antibody, cytochrome P450 subfamily 2B antibody, cytochrome P450 2B11-like antibody, CYP2B6 antibody, CYP4F3 antibody, cyp2b6.L antibody, Cyp21a1 antibody, LOC100068603 antibody

Background: This gene, CYP2B6, encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids.

Molecular Weight: 56 kDa (MW of target protein)