CETP antibody (Middle Region)
-
- Target See all CETP Antibodies
- CETP (Cholesteryl Ester Transfer Protein (CETP))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CETP antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CETP antibody was raised against the middle region of CETP
- Purification
- Affinity purified
- Immunogen
- CETP antibody was raised using the middle region of CETP corresponding to a region with amino acids KKLFLSLLDFQITPKTVSNLTESSSESVQSFLQSMITAVGIPEVMSRLEV
- Top Product
- Discover our top product CETP Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CETP Blocking Peptide, catalog no. 33R-4481, is also available for use as a blocking control in assays to test for specificity of this CETP antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CETP antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CETP (Cholesteryl Ester Transfer Protein (CETP))
- Alternative Name
- CETP (CETP Products)
- Synonyms
- BPIFF antibody, HDLCQ10 antibody, hdlcq10 antibody, cholesteryl ester transfer protein antibody, cholesteryl ester transfer protein L homeolog antibody, CETP antibody, cetp.L antibody, Cetp antibody
- Background
- CETP involved in the transfer of insoluble cholesteryl esters in the reverse transport of cholesterol. Defects in CETP are a cause of hyperalphalipoproteinemia. Cholesteryl ester transfer protein (CETP) transfers cholesteryl esters between lipoproteins. CETP may effect susceptibility to atherosclerosis.
- Molecular Weight
- 53 kDa (MW of target protein)
-