Haptoglobin antibody (Middle Region)

Catalog No. ABIN633992

Product Details anti-Haptoglobin Antibody

Target: Haptoglobin (HP)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Haptoglobin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Haptoglobin antibody was raised against the middle region of HP

Purification: Affinity purified

Immunogen: Haptoglobin antibody was raised using the middle region of HP corresponding to a region with amino acids NANFKFTDHLKYVMLPVADQDQCIRHYEGSTVPEKKTPKSPVGVQPILNE

Application Details

Application Notes: WB: 0.0125 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Haptoglobin Blocking Peptide, catalog no. 33R-6640, is also available for use as a blocking control in assays to test for specificity of this Haptoglobin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Haptoglobin

Target: Haptoglobin (HP)

Alternative Name: Haptoglobin (HP Products)

Synonyms: HP antibody, wu:fb64e01 antibody, BP antibody, HP2ALPHA2 antibody, HPA1S antibody, HP-1 antibody, HPR antibody, Zonulin antibody, haptoglobin antibody, haptoglobin-like antibody, HP antibody, hp antibody, Hp antibody, LOC479668 antibody, LOC101102413 antibody

Background: This gene encodes a preproprotein, which is processed to yield both alpha and beta chains, which subsequently combine as a tetramer to produce haptoglobin. Haptoglobin functions to bind free plasma hemoglobin.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis