PCSK1 antibody (Middle Region)

Catalog No. ABIN633993

Product Details anti-PCSK1 Antibody

Target: PCSK1 (Proprotein Convertase Subtilisin/kexin Type 1 (PCSK1))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCSK1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PCSK1 antibody was raised against the middle region of PCSK1

Purification: Affinity purified

Immunogen: PCSK1 antibody was raised using the middle region of PCSK1 corresponding to a region with amino acids QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCSK1 Blocking Peptide, catalog no. 33R-7733, is also available for use as a blocking control in assays to test for specificity of this PCSK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCSK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCSK1

Target: PCSK1 (Proprotein Convertase Subtilisin/kexin Type 1 (PCSK1))

Alternative Name: PCSK1 (PCSK1 Products)

Synonyms: BMIQ12 antibody, NEC1 antibody, PC1 antibody, PC3 antibody, SPC3 antibody, Nec-1 antibody, Nec1 antibody, Phpp-1 antibody, BDP antibody, PC1/3 antibody, proprotein convertase subtilisin/kexin type 1 antibody, prohormone convertase 1 antibody, PCSK1 antibody, Pcsk1 antibody, pcsk1 antibody, PC1B antibody

Background: PCSK1 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin and insulin.

Molecular Weight: 71 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism