PAI1 antibody (C-Term)

Catalog No. ABIN634000

Product Details anti-PAI1 Antibody

Target: PAI1 (SERPINE1) (Plasminogen Activator Inhibitor 1 (SERPINE1))

Binding Specificity: C-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAI1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: SERPINE1 antibody was raised against the C terminal of SERPINE1

Purification: Affinity purified

Immunogen: SERPINE1 antibody was raised using the C terminal of SERPINE1 corresponding to a region with amino acids VNESGTVASSSTAVIVSARMAPEEIIMDRPFLFVVRHNPTGTVLFMGQVM

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SERPINE1 Blocking Peptide, catalog no. 33R-9703, is also available for use as a blocking control in assays to test for specificity of this SERPINE1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SERPINE1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAI1

Target: PAI1 (SERPINE1) (Plasminogen Activator Inhibitor 1 (SERPINE1))

Alternative Name: SERPINE1 (SERPINE1 Products)

Synonyms: PAI antibody, PAI-1 antibody, PAI1 antibody, PLANH1 antibody, SERPINE1 antibody, si:ch211-138a11.1 antibody, Planh1 antibody, PAI1A antibody, Pai1 antibody, Pai1aa antibody, Planh antibody, RATPAI1A antibody, serpin family E member 1 antibody, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 L homeolog antibody, serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 1 antibody, serine (or cysteine) peptidase inhibitor, clade E, member 1 antibody, SERPINE1 antibody, serpine1.L antibody, serpine1 antibody, Serpine1 antibody

Background: SERPINE1 acts as 'bait' for tissue plasminogen activator, urokinase, and protein C. Its rapid interaction with TPA may function as a major control point in the regulation of fibrinolysis.

Molecular Weight: 43 kDa (MW of target protein)

Pathways: p53 Signaling, Cellular Response to Molecule of Bacterial Origin, Carbohydrate Homeostasis, Autophagy, Smooth Muscle Cell Migration