Follistatin antibody (Middle Region)

Catalog No. ABIN634005

Product Details anti-Follistatin Antibody

Target: Follistatin (FST)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Follistatin antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: FST antibody was raised against the middle region of FST

Purification: Affinity purified

Immunogen: FST antibody was raised using the middle region of FST corresponding to a region with amino acids ALLKARCKEQPELEVQYQGRCKKTCRDVFCPGSSTCVVDQTNNAYCVTCN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FST Blocking Peptide, catalog no. 33R-1350, is also available for use as a blocking control in assays to test for specificity of this FST antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FST antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Follistatin

Target: Follistatin (FST)

Alternative Name: FST (FST Products)

Synonyms: CG12955 antibody, CG12956 antibody, CG33466 antibody, Dmel\\CG33466 antibody, Fol1 antibody, dFS antibody, dFol1 antibody, dfs antibody, fs antibody, FS antibody, foll antibody, xfs antibody, FST antibody, fst antibody, AL033346 antibody, FOL1 antibody, Fst-288 antibody, RATFOL1 antibody, cb446 antibody, fd07h10 antibody, fst1 antibody, wu:fd07h10 antibody, Follistatin antibody, follistatin antibody, follistatin L homeolog antibody, follistatin a antibody, Fs antibody, fst antibody, FST antibody, LOC100141662 antibody, fst.L antibody, Fst antibody, fsta antibody

Background: Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. Follistatin is a single-chain gonadal protein that specifically inhibits follicle-stimulating hormone release. The single FST gene encodes two isoforms, FST317 and FST344 containing 317 and 344 amino acids respectively, resulting from alternative splicing of the precursor mRNA. In a study in which 37 candidate genes were tested for linkage and association with polycystic ovary syndrome (PCOS) or hyperandrogenemia in 150 families, evidence was found for linkage between PCOS and follistatin.

Molecular Weight: 35 kDa (MW of target protein)

Pathways: Negative Regulation of Hormone Secretion