GLA antibody (N-Term)

Catalog No. ABIN634024

Product Details anti-GLA Antibody

Target: GLA (Galactosidase, alpha (GLA))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GLA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GLA antibody was raised against the N terminal of GLA

Purification: Affinity purified

Immunogen: GLA antibody was raised using the N terminal of GLA corresponding to a region with amino acids PQRFPHGIRQLANYVHSKGLKLGIYADVGNKTCAGFPGSFGYYDIDAQTF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GLA Blocking Peptide, catalog no. 33R-7310, is also available for use as a blocking control in assays to test for specificity of this GLA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GLA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GLA

Target: GLA (Galactosidase, alpha (GLA))

Alternative Name: GLA (GLA Products)

Synonyms: GALA antibody, Ags antibody, zgc:101584 antibody, MGC130872 antibody, SMU.877 antibody, SCF11.21 antibody, AO090005000217 antibody, alpha-GAL antibody, galactosidase alpha antibody, galactosidase, alpha antibody, galactosidase alpha S homeolog antibody, alpha-galactosidase antibody, aga antibody, alpha-galactosidase A antibody, GLA antibody, Gla antibody, gla antibody, gla.S antibody, agaN antibody, aga antibody, agaL antibody, SCO0541 antibody, rafA antibody, melA antibody, galA antibody, ANI_1_2528074 antibody, ANI_1_1502124 antibody, AOR_1_390174 antibody, CpipJ_CPIJ002066 antibody, MCYG_00962 antibody, MCYG_00791 antibody, Tsp_02909 antibody, Tsp_02508 antibody

Background: GLA is a homodimeric glycoprotein that hydrolyses the terminal alpha-galactosyl moieties from glycolipids and glycoproteins. This enzyme predominantly hydrolyzes ceramide trihexoside, and it can catalyze the hydrolysis of melibiose into galactose and glucose. A variety of mutations in this gene affect the synthesis, processing, and stability of this enzyme, which causes Fabry disease, a rare lysosomal storage disorder that results from a failure to catabolize alpha-D-galactosyl glycolipid moieties.

Molecular Weight: 45 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome