Elastase 4 antibody

Catalog No. ABIN634038

Product Details anti-Elastase 4 Antibody

Target: Elastase 4 (CTRC) (Chymotrypsin C (Caldecrin) (CTRC))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Elastase 4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Chymotrypsin C antibody was raised using a synthetic peptide corresponding to a region with amino acids LGITVLAALLACASSCGVPSFPPNLSARVVGGEDARPHSWPWQISLQYLK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Chymotrypsin C Blocking Peptide, catalog no. 33R-4977, is also available for use as a blocking control in assays to test for specificity of this Chymotrypsin C antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTRC antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Elastase 4

Target: Elastase 4 (CTRC) (Chymotrypsin C (Caldecrin) (CTRC))

Alternative Name: Chymotrypsin C (CTRC Products)

Synonyms: CLCR antibody, ELA4 antibody, 1810044E12Rik antibody, bPTLP antibody, chymotrypsin C antibody, chymotrypsin-C antibody, chymotrypsin C (caldecrin) antibody, CTRC antibody, LOC478220 antibody, Ctrc antibody

Background: CTRC is a member of the peptidase S1 family. The protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined. This gene encodes a member of the peptidase S1 family. The encoded protein is a serum calcium-decreasing factor that has chymotrypsin-like protease activity. Alternatively spliced transcript variants have been observed, but their full-length nature has not been determined.

Molecular Weight: 27 kDa (MW of target protein)