ASAH1 antibody

Catalog No. ABIN634056

Product Details anti-ASAH1 Antibody

Target: ASAH1 (N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ASAH1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ASAH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ASAH1 Blocking Peptide, catalog no. 33R-6282, is also available for use as a blocking control in assays to test for specificity of this ASAH1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASAH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ASAH1

Target: ASAH1 (N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1))

Alternative Name: ASAH1 (ASAH1 Products)

Synonyms: AC antibody, ACDase antibody, ASAH antibody, PHP antibody, PHP32 antibody, SMAPME antibody, 2310081N20Rik antibody, Asah antibody, MGC82286 antibody, asah1 antibody, zgc:101637 antibody, ASAH1 antibody, zgc:66026 antibody, N-acylsphingosine amidohydrolase 1 antibody, N-acylsphingosine amidohydrolase (acid ceramidase) 1 antibody, N-acylsphingosine amidohydrolase (acid ceramidase) 1 L homeolog antibody, N-acylsphingosine amidohydrolase (acid ceramidase) 1a antibody, Acid ceramidase antibody, N-acylsphingosine amidohydrolase (acid ceramidase) 1b antibody, ASAH1 antibody, Asah1 antibody, asah1.L antibody, asah1a antibody, asah-1 antibody, asah1b antibody

Background: This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally.

Molecular Weight: 14 kDa (MW of target protein)