HS3ST1 antibody (Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 1)

Details for Product anti-HS3ST1 Antibody No. ABIN634065
Antigen
  • 3OST1
  • 3OST
  • 3-Ost
  • D5Wsu110e
  • Hsg3ost
  • heparan sulfate-glucosamine 3-sulfotransferase 1 L homeolog
  • heparan sulfate-glucosamine 3-sulfotransferase 1
  • heparan sulfate (glucosamine) 3-O-sulfotransferase 1
  • hs3st1.L
  • HS3ST1
  • hs3st1
  • Hs3st1
Alternatives
anti-Human HS3ST1 antibody for Western Blotting
Reactivity
Human
25
5
5
3
2
2
1
1
1
1
1
Host
Rabbit
16
6
3
Clonality
Polyclonal
Conjugate
This HS3ST1 antibody is un-conjugated
1
1
1
Application
Western Blotting (WB)
21
15
4
1
Options
Immunogen HS3 ST1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TKGFYCLRDSGRDRCLHESKGRAHPQVDPKLLNKLHEYFHEPNKKFFELV
Purification Affinity purified
Plasmids, Primers & others Plasmids, Primers & others HS3ST1 products on genomics-online (e.g. as negative or positive controls)
Antigen
Alternative Name HS3ST1 (HS3ST1 Antibody Abstract)
Background HS3ST1 is the rate limiting enzyme for synthesis of HSact. HS3ST1 performs the crucial step modification in the biosynthesis of anticoagulant heparan sulfate (HSact) that is to complete the structure of the antithrombin pentasaccharide binding site.Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities.
Molecular Weight 34 kDa (MW of target protein)
Pathways Glycosaminoglycan Metabolic Process
Application Notes WB: 1 µg/mL
Optimal conditions should be determined by the investigator.
Comment

HS3ST1 Blocking Peptide, catalog no. 33R-9139, is also available for use as a blocking control in assays to test for specificity of this HS3ST1 antibody

Restrictions For Research Use only
Format Lyophilized
Reconstitution Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HS0 T1 antibody in PBS
Concentration Lot specific
Buffer PBS
Handling Advice Avoid repeated freeze/thaw cycles.
Storage 4 °C
Storage Comment Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
Supplier Images
Western Blotting (WB) image for anti-Heparan Sulfate (Glucosamine) 3-O-Sulfotransferase 1 (HS3ST1) antibody (ABIN634065) HS3ST1 antibody used at 1 ug/ml to detect target protein.
Did you look for something else?