Cyclin Y antibody (Middle Region)

Catalog No. ABIN634074

Product Details anti-Cyclin Y Antibody

Target: Cyclin Y (CCNY)

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cyclin Y antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: Cyclin Y antibody was raised against the middle region of CCNY

Purification: Affinity purified

Immunogen: Cyclin Y antibody was raised using the middle region of CCNY corresponding to a region with amino acids DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Cyclin Y Blocking Peptide, catalog no. 33R-1914, is also available for use as a blocking control in assays to test for specificity of this Cyclin Y antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCNY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cyclin Y

Target: Cyclin Y (CCNY)

Alternative Name: Cyclin Y (CCNY Products)

Synonyms: CG14939 antibody, Dcyclin Y antibody, Dmel\\CG14939 antibody, anon-WO0118547.165 antibody, i182 antibody, C10orf9 antibody, CBCP1 antibody, CCNX antibody, CFP1 antibody, 1700025H17Rik antibody, 3110050L10Rik antibody, 4631402G10Rik antibody, 5730405I09Rik antibody, RGD1565969 antibody, cyclin Y antibody, Cyclin Y antibody, cyclin Y like 1 antibody, CCNY antibody, CycY antibody, Ccny antibody, CCNYL1 antibody

Background: CCNY belongs to the cyclin family, Cyclin Y subfamily. It contains 1 cyclin N-terminal domain. Single nucleotide polymorphism in CCNY gene is associated with Crohn's disease and ulcerative colitis.

Molecular Weight: 39 kDa (MW of target protein)