RFC3 antibody
-
- Target See all RFC3 Antibodies
- RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This RFC3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- RFC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids IIMKGLLSELLHNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKF
- Top Product
- Discover our top product RFC3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
RFC3 Blocking Peptide, catalog no. 33R-4003, is also available for use as a blocking control in assays to test for specificity of this RFC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RFC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- RFC3 (Replication Factor C (Activator 1) 3, 38kDa (RFC3))
- Alternative Name
- RFC3 (RFC3 Products)
- Synonyms
- CG5313 antibody, DRFC antibody, DmRFC3 antibody, Dmel\\CG5313 antibody, Rfc3 antibody, 21.m02902 antibody, 2810416I22Rik antibody, 38kDa antibody, AU022547 antibody, Recc3 antibody, cb275 antibody, RFC38 antibody, Replication factor C subunit 3 antibody, replication factor C3 antibody, replication factor C subunit 3 antibody, replication factor C 38 kDa subunit antibody, DNA replication factor C complex subunit Rfc3 antibody, replication factor C3, putative antibody, replication factor C (activator 1) 3 antibody, replication factor C subunit 3 L homeolog antibody, RfC3 antibody, PF14_0601 antibody, Chro.30359 antibody, PB000006.01.0 antibody, PC000345.04.0 antibody, TP04_0380 antibody, Tb09.211.3310 antibody, PY04255 antibody, PVX_117300 antibody, BBOV_IV003080 antibody, SJAG_02182 antibody, PKH_124240 antibody, rfc3 antibody, Rfc3 antibody, RFC3 antibody, rfc3.L antibody
- Background
- The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC3 is the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits.
- Molecular Weight
- 40 kDa (MW of target protein)
- Pathways
- Telomere Maintenance, DNA Damage Repair, DNA Replication, Synthesis of DNA
-