KIF1A antibody (N-Term)

Catalog No. ABIN634107

Product Details anti-KIF1A Antibody

Target: KIF1A (Kinesin Family Member 1A (KIF1A))

Binding Specificity: N-Term

Reactivity: Mouse, Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KIF1A antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: KIF1 A antibody was raised against the N terminal of KIF1

Purification: Affinity purified

Immunogen: KIF1 A antibody was raised using the N terminal of KIF1 corresponding to a region with amino acids TTIVNPKQPKETPKSFSFDYSYWSHTSPEDINYASQKQVYRDIGEEMLQH

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

KIF1A Blocking Peptide, catalog no. 33R-9321, is also available for use as a blocking control in assays to test for specificity of this KIF1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KIF0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KIF1A

Target: KIF1A (Kinesin Family Member 1A (KIF1A))

Alternative Name: KIF1A (KIF1A Products)

Synonyms: ATSV antibody, C630002N23Rik antibody, Gm1626 antibody, Kns1 antibody, C2orf20 antibody, HSN2C antibody, MRD9 antibody, SPG30 antibody, UNC104 antibody, kinesin family member 1A antibody, kinesin family member 1Aa antibody, KIF1A antibody, kif1a antibody, Kif1a antibody, kif1aa antibody

Background: The protein encoded by this gene is a member of the kinesin family. This protein is highly similar to mouse heavy chain kinesin member 1A protein which is an anterograde motor protein that transports membranous organelles along axonal microtubules. It is thought that this protein may play a critical role in the development of axonal neuropathies resulting from impaired axonal transport.

Molecular Weight: 191 kDa (MW of target protein)