REC8 antibody

Catalog No. ABIN634121

Product Details anti-REC8 Antibody

Target: REC8 (REC8 Homolog (Yeast) (REC8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This REC8 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: Rec8 antibody was raised using a synthetic peptide corresponding to a region with amino acids QLQIGVIRVYSQQCQYLVEDIQHILERLHRAQLQIRIDMETELPSLLLPN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Rec8 Blocking Peptide, catalog no. 33R-7641, is also available for use as a blocking control in assays to test for specificity of this Rec8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of REC8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for REC8

Target: REC8 (REC8 Homolog (Yeast) (REC8))

Alternative Name: Rec8 (REC8 Products)

Synonyms: Rec8L1 antibody, mrec antibody, HR21spB antibody, REC8L1 antibody, Rec8p antibody, REC8 meiotic recombination protein antibody, REC8 homolog (yeast) antibody, REC8 antibody, Rec8 antibody

Background: REC8 is required during meiosis for separation of sister chromatids and homologous chromosomes. Proteolytic cleavage of REC8 on chromosome arms by separin during anaphase I allows for homologous chromosome separation in meiosis I and cleavage of REC8 on centromeres during anaphase II allows for sister chromatid separation in meiosis II.

Molecular Weight: 62 kDa (MW of target protein)