14-3-3 sigma/SFN antibody (Middle Region)
-
- Target See all 14-3-3 sigma/SFN (SFN) Antibodies
- 14-3-3 sigma/SFN (SFN) (Stratifin (SFN))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This 14-3-3 sigma/SFN antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SFN antibody was raised against the middle region of SFN
- Purification
- Affinity purified
- Immunogen
- SFN antibody was raised using the middle region of SFN corresponding to a region with amino acids FHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLT
- Top Product
- Discover our top product SFN Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SFN Blocking Peptide, catalog no. 33R-2923, is also available for use as a blocking control in assays to test for specificity of this SFN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- 14-3-3 sigma/SFN (SFN) (Stratifin (SFN))
- Alternative Name
- SFN (SFN Products)
- Synonyms
- YWHAS antibody, Er antibody, Mme1 antibody, Ywhas antibody, stratifin antibody, SFN antibody, Sfn antibody
- Background
- SFN is an adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathway. SFN binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. When bound to KRT17, SFN regulates protein synthesis and epithelial cell growth by stimulating Akt/mTOR pathway.
- Molecular Weight
- 28 kDa (MW of target protein)
- Pathways
- p53 Signaling, Myometrial Relaxation and Contraction
-