MLH3 antibody

Catalog No. ABIN634149

Product Details anti-MLH3 Antibody

Target: MLH3 (MutL Homolog 3 (MLH3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MLH3 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: MLH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMQVLQQVDNKFIACLMSTKTEENGEADSYEKQQAQGSGRKKLLSSTLIP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MLH3 Blocking Peptide, catalog no. 33R-8644, is also available for use as a blocking control in assays to test for specificity of this MLH3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLH3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MLH3

Target: MLH3 (MutL Homolog 3 (MLH3))

Alternative Name: MLH3 (MLH3 Products)

Synonyms: AV125803 antibody, BB126472 antibody, MGC80774 antibody, MLH3 antibody, HNPCC7 antibody, mutL homolog 3 antibody, mutL homolog 3 L homeolog antibody, Mlh3 antibody, mlh3.L antibody, MLH3 antibody, mlh3 antibody

Background: This gene is a member of the MutL-homolog (MLH) family of DNA mismatch repair (MMR) genes. MLH genes are implicated in maintaining genomic integrity during DNA replication and after meiotic recombination. MLH3 functions as a heterodimer with other family members. Somatic mutations in this gene frequently occur in tumors exhibiting microsatellite instability, and germline mutations have been linked to hereditary nonpolyposis colorectal cancer type 7 (HNPCC7). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.

Molecular Weight: 161 kDa (MW of target protein)

Pathways: Chromatin Binding