ORC4 antibody

Catalog No. ABIN634162

Product Details anti-ORC4 Antibody

Target: ORC4 (Origin Recognition Complex, Subunit 4 (ORC4))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ORC4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: ORC4 L antibody was raised using a synthetic peptide corresponding to a region with amino acids VLEICLIIAMKHLNDIYEEEPFNFQMVYNEFQKFVQRKAHSVYNFEKPVV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ORC4L Blocking Peptide, catalog no. 33R-9651, is also available for use as a blocking control in assays to test for specificity of this ORC4L antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ORC0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ORC4

Target: ORC4 (Origin Recognition Complex, Subunit 4 (ORC4))

Alternative Name: ORC4L (ORC4 Products)

Synonyms: ORC4L antibody, ORC4P antibody, Orc4P antibody, Orc4l antibody, mMmORC4 antibody, CG2917 antibody, DmORC4 antibody, Dmel\\CG2917 antibody, ORC antibody, ORC4 antibody, dmOrc4 antibody, orc4 antibody, rDmORC antibody, orc4l antibody, fc50c03 antibody, wu:fc50c03 antibody, zgc:85772 antibody, ATORC4 antibody, F23H14.9 antibody, F23H14_9 antibody, ORIGIN RECOGNITION COMPLEX SUBUNIT 4 antibody, origin recognition complex subunit 4 antibody, origin recognition complex subunit 4 antibody, origin recognition complex, subunit 4 antibody, Origin recognition complex subunit 4 antibody, origin recognition complex subunit 4 L homeolog antibody, origin recognition complex subunit Orc4 antibody, ORC4 antibody, Orc4 antibody, orc4.L antibody, orc4 antibody, CNM01830 antibody

Background: The origin recognition complex (ORC) is a highly conserved six subunit protein complex essential for the initiation of the DNA replication in eukaryotic cells.

Molecular Weight: 50 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA