SPO11 antibody

Catalog No. ABIN634167

Product Details anti-SPO11 Antibody

Target: SPO11 (SPO11 Meiotic Protein Covalently Bound To DSB Homolog (SPO11))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SPO11 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: SPO11 antibody was raised using a synthetic peptide corresponding to a region with amino acids KFSLILKILSMIYKLVQSNTYATKRDIYYTDSQLFGNQTVVDNIINDISC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SPO11 Blocking Peptide, catalog no. 33R-4380, is also available for use as a blocking control in assays to test for specificity of this SPO11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPO11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SPO11

Target: SPO11 (SPO11 Meiotic Protein Covalently Bound To DSB Homolog (SPO11))

Alternative Name: SPO11 (SPO11 Products)

Synonyms: CT35 antibody, SPATA43 antibody, TOPVIA antibody, zgc:77876 antibody, AI449549 antibody, Meiotic recombination protein spo-11 antibody, SPO11, initiator of meiotic double stranded breaks antibody, SPO11 meiotic protein covalently bound to DSB antibody, spo-11 antibody, SPO11 antibody, Spo11 antibody, spo11 antibody

Background: Meiotic recombination and chromosome segregation require the formation of double-strand breaks (DSBs) in paired chromosome homologs. During meiosis in yeast, a meiotic recombination protein is covalently-linked to the 5' end of DSBs and is essential for the formation of DSBs. SPO11 is similar in sequence and conserved features to the yeast meiotic recombination protein. It belongs to the TOP6A protein family.

Molecular Weight: 44 kDa (MW of target protein)