MSH4 antibody
-
- Target See all MSH4 Antibodies
- MSH4 (MutS Homolog 4 (E. Coli) (MSH4))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This MSH4 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- MSH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIY
- Top Product
- Discover our top product MSH4 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
MSH4 Blocking Peptide, catalog no. 33R-2488, is also available for use as a blocking control in assays to test for specificity of this MSH4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MSH4 (MutS Homolog 4 (E. Coli) (MSH4))
- Alternative Name
- MSH4 (MSH4 Products)
- Synonyms
- MSH4 antibody, 4930485C04Rik antibody, AV144863 antibody, mMsh4 antibody, mutS homolog 4 antibody, mutS protein homolog 4 antibody, Msh4 antibody, MSH4 antibody, msh4 antibody, LOC575381 antibody, LOC100639599 antibody
- Background
- MSH4 is involved in meiotic recombination. MSH4 is required for reciprocal recombination and proper segregation of homologous chromosomes at meiosis.
- Molecular Weight
- 105 kDa (MW of target protein)
-