MSH4 antibody

Catalog No. ABIN634190

Product Details anti-MSH4 Antibody

Target: MSH4 (MutS Homolog 4 (E. Coli) (MSH4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MSH4 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: MSH4 antibody was raised using a synthetic peptide corresponding to a region with amino acids EITTQITRQILQNQRSTPEMERQRAVYHLATRLVQTARNSQLDPDSLRIY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MSH4 Blocking Peptide, catalog no. 33R-2488, is also available for use as a blocking control in assays to test for specificity of this MSH4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MSH4

Target: MSH4 (MutS Homolog 4 (E. Coli) (MSH4))

Alternative Name: MSH4 (MSH4 Products)

Synonyms: MSH4 antibody, 4930485C04Rik antibody, AV144863 antibody, mMsh4 antibody, mutS homolog 4 antibody, mutS protein homolog 4 antibody, Msh4 antibody, MSH4 antibody, msh4 antibody, LOC575381 antibody, LOC100639599 antibody

Background: MSH4 is involved in meiotic recombination. MSH4 is required for reciprocal recombination and proper segregation of homologous chromosomes at meiosis.

Molecular Weight: 105 kDa (MW of target protein)