BUB3 antibody
-
- Target See all BUB3 Antibodies
- BUB3 (Budding Uninhibited By Benzimidazoles 3 Homolog (Yeast) (BUB3))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This BUB3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- BUB3 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTGSNEFKLNQPPEDGISSVKFSPNTSQFLLVSSWDTSVRLYDVPANSMR
- Top Product
- Discover our top product BUB3 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
BUB3 Blocking Peptide, catalog no. 33R-6544, is also available for use as a blocking control in assays to test for specificity of this BUB3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BUB3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BUB3 (Budding Uninhibited By Benzimidazoles 3 Homolog (Yeast) (BUB3))
- Alternative Name
- BUB3 (BUB3 Products)
- Synonyms
- BUB3L antibody, hBUB3 antibody, Aa2-050 antibody, xbub3 antibody, AU019800 antibody, AU021329 antibody, AU043350 antibody, AW146323 antibody, C78067 antibody, BUB3, mitotic checkpoint protein antibody, BUB3 mitotic checkpoint protein antibody, BUB3 mitotic checkpoint protein L homeolog antibody, BUB3 antibody, Bub3 antibody, bub3.L antibody
- Background
- BUB3 is required for kinetochore localization of BUB1.
- Molecular Weight
- 36 kDa (MW of target protein)
- Pathways
- Maintenance of Protein Location
-