MOS antibody (Middle Region)

Catalog No. ABIN634201

Product Details anti-MOS Antibody

Target: MOS (Moloney Sarcoma Oncogene (MOS))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MOS antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: MOS antibody was raised against the middle region of MOS

Purification: Affinity purified

Immunogen: MOS antibody was raised using the middle region of MOS corresponding to a region with amino acids LNVARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGNVTLHQVIYGAAG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MOS Blocking Peptide, catalog no. 33R-5250, is also available for use as a blocking control in assays to test for specificity of this MOS antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MOS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MOS

Target: MOS (Moloney Sarcoma Oncogene (MOS))

Alternative Name: MOS (MOS Products)

Synonyms: MOS antibody, c-mos antibody, msv antibody, p39 antibody, mosxe antibody, MSV antibody, p39-mos antibody, MOS proto-oncogene, serine/threonine kinase antibody, v-mos Moloney murine sarcoma viral oncogene homolog antibody, serine/threonine-protein kinase mos-like antibody, Moloney sarcoma oncogene antibody, MOS proto-oncogene, serine/threonine kinase L homeolog antibody, MOS antibody, mos antibody, LOC100229612 antibody, Mos antibody, mos.L antibody

Background: MOS is a serine/threonine kinase that activates the MAP kinase cascade through direct phosphorylation of the MAP kinase activator.

Molecular Weight: 38 kDa (MW of target protein)