CCT7 antibody

Catalog No. ABIN634207

Product Details anti-CCT7 Antibody

Target: CCT7 (Chaperonin Containing TCP1, Subunit 7 (Eta) (CCT7))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CCT7 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CCT7 antibody was raised using a synthetic peptide corresponding to a region with amino acids RAIKNDSVVAGGGAIEMELSKYLRDYSRTIPGKQQLLIGAYAKALEIIPR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCT7 Blocking Peptide, catalog no. 33R-7811, is also available for use as a blocking control in assays to test for specificity of this CCT7 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCT7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CCT7

Target: CCT7 (Chaperonin Containing TCP1, Subunit 7 (Eta) (CCT7))

Alternative Name: CCT7 (CCT7 Products)

Synonyms: Cct7 antibody, cct-eta antibody, ccth antibody, nip7-1 antibody, tcp-1-eta antibody, CCTETA antibody, CCTH antibody, NIP7-1 antibody, TCP1ETA antibody, CCT-ETA antibody, TCP-1-ETA antibody, AA408524 antibody, AL022769 antibody, Ccth antibody, Cctz antibody, chunp6934 antibody, fb38h02 antibody, fc05g05 antibody, wu:fb38h02 antibody, wu:fc05g05 antibody, chaperonin containing TCP1, subunit 7 (eta) antibody, chaperonin containing TCP1 subunit 7 antibody, chaperonin containing Tcp1, subunit 7 (eta) antibody, chaperonin containing TCP1 subunit 7 S homeolog antibody, Cct7 antibody, cct7 antibody, CCT7 antibody, cct7.S antibody

Background: CCT7 is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin.

Molecular Weight: 60 kDa (MW of target protein)