PMS2 antibody

Catalog No. ABIN634259

Product Details anti-PMS2 Antibody

Target: PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. Cerevisiae) (PMS2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PMS2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: PMS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids INKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PMS2 Blocking Peptide, catalog no. 33R-4074, is also available for use as a blocking control in assays to test for specificity of this PMS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PMS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PMS2

Target: PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. Cerevisiae) (PMS2))

Alternative Name: PMS2 (PMS2 Products)

Synonyms: HNPCC4 antibody, PMS2CL antibody, PMSL2 antibody, AW555130 antibody, Pmsl2 antibody, PMS1 homolog 2, mismatch repair system component antibody, PMS1 homolog2, mismatch repair system component antibody, mismatch repair endonuclease PMS2 antibody, PMS2 antibody, Pms2 antibody, LOC463257 antibody, LOC107984056 antibody

Background: PMS2 is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors.

Molecular Weight: 96 kDa (MW of target protein)

Pathways: DNA Damage Repair, Production of Molecular Mediator of Immune Response