PMS2 antibody
-
- Target See all PMS2 Antibodies
- PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. Cerevisiae) (PMS2))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PMS2 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PMS2 antibody was raised using a synthetic peptide corresponding to a region with amino acids INKKVVPLDFSMSSLAKRIKQLHHEAQQSEGEQNYRKFRAKICPGENQAA
- Top Product
- Discover our top product PMS2 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PMS2 Blocking Peptide, catalog no. 33R-4074, is also available for use as a blocking control in assays to test for specificity of this PMS2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PMS2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PMS2 (PMS2 Postmeiotic Segregation Increased 2 (S. Cerevisiae) (PMS2))
- Alternative Name
- PMS2 (PMS2 Products)
- Synonyms
- HNPCC4 antibody, PMS2CL antibody, PMSL2 antibody, AW555130 antibody, Pmsl2 antibody, PMS1 homolog 2, mismatch repair system component antibody, PMS1 homolog2, mismatch repair system component antibody, mismatch repair endonuclease PMS2 antibody, PMS2 antibody, Pms2 antibody, LOC463257 antibody, LOC107984056 antibody
- Background
- PMS2 is involved in DNA mismatch repair. It forms a heterodimer with MLH1 and this complex interacts with other complexes bound to mismatched bases. Mutations in this gene are associated with hereditary nonpolyposis colorectal cancer, Turcot syndrome, and are a cause of supratentorial primitive neuroectodermal tumors.
- Molecular Weight
- 96 kDa (MW of target protein)
- Pathways
- DNA Damage Repair, Production of Molecular Mediator of Immune Response
-