LZTS2 antibody (N-Term)

Catalog No. ABIN634260

Product Details anti-LZTS2 Antibody

Target: LZTS2 (Leucine Zipper, Putative Tumor Suppressor 2 (LZTS2))

Binding Specificity: N-Term

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LZTS2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: LZTS2 antibody was raised against the N terminal of LZTS2

Purification: Affinity purified

Immunogen: LZTS2 antibody was raised using the N terminal of LZTS2 corresponding to a region with amino acids EPLCPAVPPRKAVPVTSFTYINEDFRTESPPSPSSDVEDAREQRAHNAHL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LZTS2 Blocking Peptide, catalog no. 33R-2636, is also available for use as a blocking control in assays to test for specificity of this LZTS2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LZTS2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for LZTS2

Target: LZTS2 (Leucine Zipper, Putative Tumor Suppressor 2 (LZTS2))

Alternative Name: LZTS2 (LZTS2 Products)

Synonyms: lapser1 antibody, MGC89253 antibody, si:dkey-250a11.1 antibody, LAPSER1 antibody, BC014695 antibody, mKIAA1813 antibody, Lapser1 antibody, leucine zipper, putative tumor suppressor 2 antibody, leucine zipper tumor suppressor 2 antibody, leucine zipper, putative tumor suppressor 2a antibody, leucine zipper, putative tumor suppressor 2 S homeolog antibody, lzts2 antibody, LZTS2 antibody, lzts2a antibody, Lzts2 antibody, lzts2.S antibody

Background: LZTS2 is a negative regulator of katanin-mediated microtubule severing and release from the centrosome. LZTS2 is required for central spindle formation and the completion of cytokinesis.

Molecular Weight: 73 kDa (MW of target protein)