PDGFB antibody (N-Term)

Catalog No. ABIN634264

Product Details anti-PDGFB Antibody

Target: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PDGFB antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PDGFB antibody was raised against the N terminal of PDGFB

Purification: Affinity purified

Immunogen: PDGFB antibody was raised using the N terminal of PDGFB corresponding to a region with amino acids NRCWALFLSLCCYLRLVSAEGDPIPEELYEMLSDHSIRSFDDLQRLLHGD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PDGFB Blocking Peptide, catalog no. 33R-6853, is also available for use as a blocking control in assays to test for specificity of this PDGFB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDGFB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PDGFB

Target: PDGFB (Platelet Derived Growth Factor Subunit B (PDGFB))

Alternative Name: PDGFB (PDGFB Products)

Synonyms: PDGF-2 antibody, PDGF2 antibody, SIS antibody, SSV antibody, c-sis antibody, pdgf2 antibody, sis antibody, si:ch211-79m20.1 antibody, si:dkey-261d11.1 antibody, PDGF-B antibody, Sis antibody, platelet derived growth factor subunit B antibody, platelet-derived growth factor beta polypeptide antibody, platelet derived growth factor subunit B S homeolog antibody, platelet-derived growth factor beta polypeptide a antibody, platelet derived growth factor, B polypeptide antibody, PDGFB antibody, pdgfb.S antibody, pdgfba antibody, Pdgfb antibody

Background: PDGFB is a member of the platelet-derived growth factor family. The four members of this family are mitogenic factors for cells of mesenchymal origin and are characterized by a motif of eight cysteines. PDGFB can exist either as a homodimer (PDGF-BB) or as a heterodimer with the platelet-derived growth factor alpha polypeptide (PDGF-AB), where the dimers are connected by disulfide bonds. Mutations in this gene are associated with meningioma. Reciprocal translocations between chromosomes 22 and 7, at sites where this gene and that for COL1A1 are located, are associated with a particular type of skin tumor called dermatofibrosarcoma protuberans resulting from unregulated expression of growth factor.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: RTK Signaling, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Regulation of Carbohydrate Metabolic Process, Smooth Muscle Cell Migration, Platelet-derived growth Factor Receptor Signaling