EXT2 antibody

Catalog No. ABIN634281

Product Details anti-EXT2 Antibody

Target: EXT2 (Exostosin 2 (EXT2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This EXT2 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: EXT2 antibody was raised using a synthetic peptide corresponding to a region with amino acids NELLMAISDSDYYTDDINRACLFVPSIDVLNQNTLRIKETAQAMAQLSRW

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EXT2 Blocking Peptide, catalog no. 33R-6672, is also available for use as a blocking control in assays to test for specificity of this EXT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EXT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for EXT2

Target: EXT2 (Exostosin 2 (EXT2))

Alternative Name: EXT2 (EXT2 Products)

Synonyms: SOTV antibody, AI893565 antibody, EXT2 antibody, ext2 antibody, exostosin glycosyltransferase 2 antibody, exostoses (multiple) 2 antibody, exostoses (multiple) 3 antibody, exostosin glycosyltransferase 2 L homeolog antibody, EXT2 antibody, Ext2 antibody, EXT3 antibody, ext2.L antibody

Background: EXT2 is one of two glycosyltransferases involved in the chain elongation step of heparan sulfate biosynthesis.

Molecular Weight: 82 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process