GRK5 antibody (Middle Region)

Catalog No. ABIN634307

Product Details anti-GRK5 Antibody

Target: GRK5 (G Protein-Coupled Receptor Kinase 5 (GRK5))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GRK5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: GRK5 antibody was raised against the middle region of GRK5

Purification: Affinity purified

Immunogen: GRK5 antibody was raised using the middle region of GRK5 corresponding to a region with amino acids FYAAEILCGLEDLHRENTVYRDLKPENILLDDYGHIRISDLGLAVKIPEG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GRK5 Blocking Peptide, catalog no. 33R-3133, is also available for use as a blocking control in assays to test for specificity of this GRK5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRK5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GRK5

Target: GRK5 (G Protein-Coupled Receptor Kinase 5 (GRK5))

Alternative Name: GRK5 (GRK5 Products)

Background: GRK5 is a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. It has also been shown to play a role in regulating the motility of polymorphonuclear leukocytes (PMNs).

Molecular Weight: 68 kDa (MW of target protein)

Pathways: Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling