CRLF1 antibody (Middle Region)
-
- Target See all CRLF1 Antibodies
- CRLF1 (Cytokine Receptor-Like Factor 1 (CRLF1))
-
Binding Specificity
- Middle Region
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This CRLF1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- CRLF1 antibody was raised against the middle region of CRLF1
- Purification
- Affinity purified
- Immunogen
- CRLF1 antibody was raised using the middle region of CRLF1 corresponding to a region with amino acids QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGL
- Top Product
- Discover our top product CRLF1 Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
CRLF1 Blocking Peptide, catalog no. 33R-7646, is also available for use as a blocking control in assays to test for specificity of this CRLF1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRLF1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CRLF1 (Cytokine Receptor-Like Factor 1 (CRLF1))
- Alternative Name
- CRLF1 (CRLF1 Products)
- Background
- CRLF1 belongs to the type I cytokine receptor family. It is cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. The protein may be involved in nervous system development. Defects in CRLF1 are the cause of cold-induced sweating syndrome 1 and Crisponi syndrome.
- Molecular Weight
- 46 kDa (MW of target protein)
-