CRLF1 antibody (Middle Region)

Catalog No. ABIN634310

Product Details anti-CRLF1 Antibody

Target: CRLF1 (Cytokine Receptor-Like Factor 1 (CRLF1))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CRLF1 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: CRLF1 antibody was raised against the middle region of CRLF1

Purification: Affinity purified

Immunogen: CRLF1 antibody was raised using the middle region of CRLF1 corresponding to a region with amino acids QLSVRWVSPPALKDFLFQAKYQIRYRVEDSVDWKVVDDVSNQTSCRLAGL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CRLF1 Blocking Peptide, catalog no. 33R-7646, is also available for use as a blocking control in assays to test for specificity of this CRLF1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CRLF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CRLF1

Target: CRLF1 (Cytokine Receptor-Like Factor 1 (CRLF1))

Alternative Name: CRLF1 (CRLF1 Products)

Background: CRLF1 belongs to the type I cytokine receptor family. It is cytokine receptor subunit, possibly playing a regulatory role in the immune system and during fetal development. The protein may be involved in nervous system development. Defects in CRLF1 are the cause of cold-induced sweating syndrome 1 and Crisponi syndrome.

Molecular Weight: 46 kDa (MW of target protein)