C4BPA antibody (Middle Region)

Catalog No. ABIN634312

Product Details anti-C4BPA Antibody

Target: C4BPA (Complement Component 4 Binding Protein, alpha (C4BPA))

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C4BPA antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: C4 BPA antibody was raised against the middle region of C4 PA

Purification: Affinity purified

Immunogen: C4 BPA antibody was raised using the middle region of C4 PA corresponding to a region with amino acids QVLTGKRLMQCLPNPEDVKMALEVYKLSLEIEQLELQRDSARQSTLDKEL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C4BPA Blocking Peptide, catalog no. 33R-7781, is also available for use as a blocking control in assays to test for specificity of this C4BPA antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 PA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C4BPA

Target: C4BPA (Complement Component 4 Binding Protein, alpha (C4BPA))

Alternative Name: C4BPA (C4BPA Products)

Synonyms: CRES antibody, c4bp antibody, C4BP antibody, PRP antibody, complement component 4 binding protein, alpha chain antibody, C4b-binding protein alpha chain antibody, complement component 4 binding protein alpha antibody, complement component 4 binding protein, alpha antibody, LOC419851 antibody, c4bp antibody, C4BPA antibody, C4bpa antibody

Background: C4BPA is a member of a superfamily of proteins composed predominantly of tandemly arrayed short consensus repeats of approximately 60 amino acids. Along with a single, unique beta-chain, seven identical alpha-chains encoded by this gene assemble into the predominant isoform of C4b-binding protein, a multimeric protein that controls activation of the complement cascade through the classical pathway. The genes encoding both alpha and beta chains are located adjacent to each other on human chromosome 1 in the regulator of complement activation gene cluster.

Molecular Weight: 62 kDa (MW of target protein)

Pathways: Complement System