PHAP1 antibody
-
- Target See all PHAP1 (ANP32A) Antibodies
- PHAP1 (ANP32A) (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A))
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PHAP1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Purification
- Affinity purified
- Immunogen
- ANP32 A antibody was raised using a synthetic peptide corresponding to a region with amino acids FNCEVTNLNDYRENVFKLLPQLTYLDGYDRDDKEAPDSDAEGYVEGLDDE
- Top Product
- Discover our top product ANP32A Primary Antibody
-
-
- Application Notes
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
ANP32A Blocking Peptide, catalog no. 33R-3001, is also available for use as a blocking control in assays to test for specificity of this ANP32A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANP30 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PHAP1 (ANP32A) (Acidic (Leucine-Rich) Nuclear phosphoprotein 32 Family, Member A (ANP32A))
- Alternative Name
- ANP32A (ANP32A Products)
- Synonyms
- C15orf1 antibody, HPPCn antibody, I1PP2A antibody, LANP antibody, MAPM antibody, PHAP1 antibody, PHAPI antibody, PP32 antibody, Anp32 antibody, W91701 antibody, pp32 antibody, Anp32a antibody, CG5784 antibody, CT18148 antibody, CT42180 antibody, Dmel\\CG5784 antibody, anon-EST:fe3A2 antibody, wu:fj36e08 antibody, zgc:55516 antibody, ANP32D antibody, acidic nuclear phosphoprotein 32 family member A antibody, acidic (leucine-rich) nuclear phosphoprotein 32 family, member A antibody, CG5784 gene product from transcript CG5784-RB antibody, acidic nuclear phosphoprotein 32 family member A L homeolog antibody, ANP32A antibody, Anp32a antibody, Mapmodulin antibody, anp32a antibody, anp32a.L antibody
- Background
- ANP32A is a novel potent heat-stable inhibitor protein of protein phosphatase 2A. It may play a key role in self-renewing cell populations where it may act in the nucleus to limit their sensitivity to transformation. Being a tumor suppressor, ANP32A represses cell growth through inhibition of transcription by blocking acetylation and phosphorylation of histone H3 and initiating its proapoptotic activity.
- Molecular Weight
- 29 kDa (MW of target protein)
-