Peroxiredoxin 5 antibody (Middle Region)

Catalog No. ABIN634328

Product Details anti-Peroxiredoxin 5 Antibody

Target: Peroxiredoxin 5 (PRDX5)

Binding Specificity: Middle Region

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Peroxiredoxin 5 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: PRDX5 antibody was raised against the middle region of PRDX5

Purification: Affinity purified

Immunogen: PRDX5 antibody was raised using the middle region of PRDX5 corresponding to a region with amino acids TDLLLDDSLVSIFGNRRLKRFSMVVQDGIVKALNVEPDGTGLTCSLAPNI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PRDX5 Blocking Peptide, catalog no. 33R-9012, is also available for use as a blocking control in assays to test for specificity of this PRDX5 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRDX5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Peroxiredoxin 5

Target: Peroxiredoxin 5 (PRDX5)

Alternative Name: PRDX5 (PRDX5 Products)

Synonyms: acr1 antibody, aoeb166 antibody, pmp20 antibody, prx-5 antibody, prx5 antibody, prxv antibody, sbbi10 antibody, GB16965 antibody, zgc:112318 antibody, PRDX5 antibody, CG 32920 antibody, CG 7217 antibody, CG32920 antibody, CG7217 antibody, Dmel\\CG7217 antibody, dPrx5 antibody, dprx5 antibody, ACR1 antibody, AOEB166 antibody, B166 antibody, PLP antibody, PMP20 antibody, PRDX6 antibody, PRXV antibody, prx-V antibody, AOPP antibody, Pmp20 antibody, Prdx6 antibody, PrxV antibody, Aoeb166 antibody, Prx V antibody, peroxiredoxin 5 L homeolog antibody, peroxiredoxin-5, mitochondrial antibody, peroxiredoxin 5 antibody, Peroxiredoxin 5 antibody, prdx5.L antibody, LOC552429 antibody, prdx5 antibody, PRDX5 antibody, Prx5 antibody, Prdx5 antibody

Background: PRDX5 is a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in different tissues under normal conditions and during inflammatory processes. This protein interacts with peroxisome receptor 1. The crystal structure of this protein in its reduced form has been resolved to 1.5 angstrom resolution. This gene uses alternate in-frame translation initiation sites to generate mitochondrial or peroxisomal/cytoplasmic forms.

Molecular Weight: 14 kDa (MW of target protein)

Pathways: Cell RedoxHomeostasis