RPS6KA2 antibody (Middle Region)

Catalog No. ABIN634332

Product Details anti-RPS6KA2 Antibody

Target: RPS6KA2 (Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2))

Binding Specificity: Middle Region

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RPS6KA2 antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: RPS6 KA2 antibody was raised against the middle region of RPS6 A2

Purification: Affinity purified

Immunogen: RPS6 KA2 antibody was raised using the middle region of RPS6 A2 corresponding to a region with amino acids LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RPS6KA2 Blocking Peptide, catalog no. 33R-5450, is also available for use as a blocking control in assays to test for specificity of this RPS6KA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 A2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RPS6KA2

Target: RPS6KA2 (Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2))

Alternative Name: RPS6KA2 (RPS6KA2 Products)

Synonyms: HU-2 antibody, MAPKAPK1C antibody, RSK antibody, RSK3 antibody, S6K-alpha antibody, S6K-alpha2 antibody, p90-RSK3 antibody, pp90RSK3 antibody, 90kDa antibody, D17Wsu134e antibody, Rps6ka-rs1 antibody, Rsk3 antibody, p90rsk antibody, pp90rsk antibody, ribosomal protein S6 kinase A2 antibody, ribosomal protein S6 kinase, polypeptide 2 antibody, Rps6ka2 antibody, RPS6KA2 antibody

Background: RPS6KA2 is a serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB.

Molecular Weight: 81 kDa (MW of target protein)

Pathways: MAPK Signaling, Neurotrophin Signaling Pathway, Regulation of Systemic Arterial Blood Pressure by Hormones, Activation of Innate immune Response, Toll-Like Receptors Cascades