TOLLIP antibody (C-Term)

Catalog No. ABIN634351

Product Details anti-TOLLIP Antibody

Target: TOLLIP (Toll Interacting Protein (TOLLIP))

Binding Specificity: C-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TOLLIP antibody is un-conjugated

Application: Western Blotting (WB)

Specificity: TOLLIP antibody was raised against the C terminal of TOLLIP

Purification: Affinity purified

Immunogen: TOLLIP antibody was raised using the C terminal of TOLLIP corresponding to a region with amino acids MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TOLLIP Blocking Peptide, catalog no. 33R-5792, is also available for use as a blocking control in assays to test for specificity of this TOLLIP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TOLLIP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TOLLIP

Target: TOLLIP (Toll Interacting Protein (TOLLIP))

Alternative Name: TOLLIP (TOLLIP Products)

Synonyms: IL-1RAcPIP antibody, 4930403G24Rik antibody, 4931428G15Rik antibody, fk22a02 antibody, im:7145391 antibody, wu:fk22a02 antibody, zgc:76985 antibody, TOLLIP antibody, GB17961 antibody, tollip antibody, tollip1 antibody, tollipa antibody, TOLIP antibody, toll interacting protein antibody, toll-interacting protein antibody, toll-interacting protein-like antibody, toll interacting protein L homeolog antibody, toll interacting protein S homeolog antibody, Toll-interleukine I receptor interacting protein I antibody, TOLLIP antibody, Tollip antibody, tollip antibody, LOC552034 antibody, LOC100169858 antibody, tollip.L antibody, tollip.S antibody, LOC100136122 antibody

Background: TOLLIP is component of the signaling pathway of IL-1 and Toll-like receptors. It Inhibits cell activation by microbial products. It also recruits IRAK1 to the IL-1 receptor complex and inhibits IRAK1 phosphorylation and kinase activity.

Molecular Weight: 30 kDa (MW of target protein)