CAP1 antibody

Catalog No. ABIN634355

Product Details anti-CAP1 Antibody

Target: CAP1 (CAP, Adenylate Cyclase-Associated Protein 1 (CAP1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CAP1 antibody is un-conjugated

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogen: CAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MADMQNLVERLERAVGRLEAVSHTSDMHRGYADSPSKAGAAPYVQAFDSL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CAP1 Blocking Peptide, catalog no. 33R-5624, is also available for use as a blocking control in assays to test for specificity of this CAP1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CAP1

Target: CAP1 (CAP, Adenylate Cyclase-Associated Protein 1 (CAP1))

Alternative Name: CAP1 (CAP1 Products)

Synonyms: CAP antibody, CAP1-PEN antibody, CAP1 antibody, DKFZp459E1319 antibody, cap1 antibody, Mch1 antibody, fj98f01 antibody, zgc:63872 antibody, wu:fj98f01 antibody, cyclase associated actin cytoskeleton regulatory protein 1 antibody, adenylyl cyclase-associated protein 1 antibody, Cap1 CAP, adenylate cyclase-associated protein 1 antibody, CAP, adenylate cyclase-associated protein 1 (yeast) antibody, adenylate cyclase associated protein 1 antibody, adenylyl cyclase-associated protein Cap1 antibody, CAP1 antibody, LOC5580331 antibody, cap1 antibody, Cap1 antibody

Background: The protein encoded by this gene is related to the S. cerevisiae CAP protein, which is involved in the cyclic AMP pathway. The human protein is able to interact with other molecules of the same protein, as well as with CAP2 and actin.

Molecular Weight: 52 kDa (MW of target protein)

Pathways: cAMP Metabolic Process