PPM1A antibody
-
- Target See all PPM1A Antibodies
- PPM1A (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1A (PPM1A))
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PPM1A antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogen
- PPM1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK
- Top Product
- Discover our top product PPM1A Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
PPM1A Blocking Peptide, catalog no. 33R-2464, is also available for use as a blocking control in assays to test for specificity of this PPM1A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
- Avoid repeated freeze/thaw cycles.
- Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PPM1A (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1A (PPM1A))
- Alternative Name
- PPM1A (PPM1A Products)
- Synonyms
- PP2C-ALPHA antibody, PP2CA antibody, PP2Calpha antibody, pp2ca1 antibody, ppp1r13b antibody, si:ch211-253p18.1 antibody, wu:fd42g12 antibody, zgc:153820 antibody, 2310003C21Rik antibody, 2900017D14Rik antibody, AI427932 antibody, AU017636 antibody, MMPa-2 antibody, MPPa-1 antibody, Pp2c1 antibody, pp2c-alpha antibody, pp2ca antibody, pp2calpha antibody, pp2ca2 antibody, protein phosphatase, Mg2+/Mn2+ dependent 1A antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1Ab antibody, protein phosphatase 1A, magnesium dependent, alpha isoform antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1A antibody, protein phosphatase, Mg2+/Mn2+ dependent 1A L homeolog antibody, protein phosphatase, Mg2+/Mn2+ dependent, 1Aa antibody, PPM1A antibody, ppm1ab antibody, Ppm1a antibody, ppm1a.L antibody, ppm1aa antibody
- Background
- The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways.
- Molecular Weight
- 36 kDa (MW of target protein)
-