SHB antibody (N-Term)
-
- Target See all SHB Antibodies
- SHB (Src Homology 2 Domain Containing Adaptor Protein B (SHB))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SHB antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Specificity
- SHB antibody was raised against the N terminal of SHB
- Purification
- Affinity purified
- Immunogen
- SHB antibody was raised using the N terminal of SHB corresponding to a region with amino acids MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSA
- Top Product
- Discover our top product SHB Primary Antibody
-
-
- Application Notes
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Comment
-
SHB Blocking Peptide, catalog no. 33R-5681, is also available for use as a blocking control in assays to test for specificity of this SHB antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHB antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Handling Advice
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Storage
- 4 °C/-20 °C
- Storage Comment
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SHB (Src Homology 2 Domain Containing Adaptor Protein B (SHB))
- Alternative Name
- SHB (SHB Products)
- Synonyms
- SHB antibody, RP11-3J10.8 antibody, bA3J10.2 antibody, RGD1565350 antibody, BC028832 antibody, SH2 domain containing adaptor protein B antibody, src homology 2 domain-containing transforming protein B antibody, SHB antibody, Shb antibody
- Background
- SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling.
- Molecular Weight
- 55 kDa (MW of target protein)
-